Protein coding transcript 1341

• Transcript: Ll_transcript_444658
• CDS coordinates: 27-542 (+)
• Peptide sequence: MDFAIDMFKQTKKTKGRKKIEIKKLDKNSNKQVTFSKRRAGLFKKGSELCVLCNVDATIIVFSPADKLFCFGQPDVETLITRYLRRTTEMDHKIPRSETVSYEEHNKEYDEAMKKLEMEKKELANSGKDWKKGNWWNEPIHEMSAEELEQFMVAVYELRRKLDERRGEIMM*
• ORF Type: complete

Annotations of Ll_transcript_444658

• Blastp: Agamous-like MADS-box protein AGL62 from Arabidopsis with 41.18% of identity
• Blastx: Agamous-like MADS-box protein AGL61 from Arabidopsis with 39.86% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G60440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436118.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;