Transcript | Ll_transcript_444658 |
---|---|
CDS coordinates | 27-542 (+) |
Peptide sequence | MDFAIDMFKQTKKTKGRKKIEIKKLDKNSNKQVTFSKRRAGLFKKGSELCVLCNVDATIIVFSPADKLFCFGQPDVETLITRYLRRTTEMDHKIPRSETVSYEEHNKEYDEAMKKLEMEKKELANSGKDWKKGNWWNEPIHEMSAEELEQFMVAVYELRRKLDERRGEIMM* |
ORF Type | complete |
Blastp | Agamous-like MADS-box protein AGL62 from Arabidopsis with 41.18% of identity |
---|---|
Blastx | Agamous-like MADS-box protein AGL61 from Arabidopsis with 39.86% of identity |
Eggnog | Transcription factor(COG5068) |
Kegg | Link to kegg annotations (AT5G60440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436118.1) |
Pfam | SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer