Transcript | Ll_transcript_400763 |
---|---|
CDS coordinates | 2114-2749 (+) |
Peptide sequence | MLDAICERLKPALSTEGTYLVREGDPVNEMLFIIRGHLDSYTTNGGRAGFFNSCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIAEDLKFVASQYRRLHSKQLRNRFRFYSHHWRTWAACFVQAAWRRHKKKKDAAELRIKANAKNVEVEKPTSSGPGLVVYATRVARSTRKGVNEVVNSLQKPSEPDFSVDEWRNS* |
ORF Type | complete |
Blastp | Protein CNGC15c from Medicago with 82.71% of identity |
---|---|
Blastx | Protein CNGC15c from Medicago with 83.18% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_2g094860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447859.1) |
Pfam | Cyclic nucleotide-binding domain (PF00027.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer