Transcript | Ll_transcript_271093 |
---|---|
CDS coordinates | 79-444 (+) |
Peptide sequence | MGLGRGSAVLLLLCLFVIQSEIVNAATYTVGGAGGWTFNTNGWPKGKRFRAGDRLVFNYGRGAHNVAVVNKGGYAGCNTPRGSKVYRSGKDQITLSRGMNYFICSFVGHCQFGMKIAIYAP* |
ORF Type | complete |
Blastp | Basic blue protein from Arabidopsis with 54.69% of identity |
---|---|
Blastx | Basic blue protein from Arabidopsis with 54.69% of identity |
Eggnog | Basic blue(ENOG410YPS7) |
Kegg | Link to kegg annotations (AT2G02850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461867.1) |
Pfam | Plastocyanin-like domain (PF02298.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer