Protein coding transcript 134145

• Transcript: Ll_transcript_271101
• CDS coordinates: 2-643 (+)
• Peptide sequence: EMVNTGFTPDVVTWTTLIGGFCEVGRPLAAKELFFGMHKYGQVPNLQTCAIILNGLCKCQLLSEAISLLETMEKSNLDLNIVIYSILLDGLCNAGKISEAWEFFSSIPAKGLKINVYTYTIMIKGFCKQGLMSEAEDLLRNMDENGCRPDGCTYNVFVQGLLIKKEAAESIKYLKIMTEKGFSVDAATTEMIINYLSTNEGDTAFREFLFPNR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_271101

• Blastp: Pentatricopeptide repeat-containing protein At1g12300, mitochondrial from Arabidopsis with 44.02% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g12300, mitochondrial from Arabidopsis with 44.02% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G12300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460489.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;