Protein coding transcript 134197

• Transcript: Ll_transcript_271077
• CDS coordinates: 43-759 (+)
• Peptide sequence: MADIHDTSVTSSMHNPSCDNDESCSHNIGKLYRGVRKRKWGKWVSEIRLPNSRERIWLGSYDTQLKAARAFDAALYILRGNNACFNFPDTPLNMNMNNVVVPRDQPLSPQEVQEVAAKFANYSHTPLETQEEEEEEPSESQSGVDSFGLFESKTTSLGYDNYDGNIETMDWTFLNMLDDDSNAVAGFDCRPYYSELDKIYSSGELSYYTQPPALEDNGDEIEGGDAFSNHSILWSWNF*
• ORF Type: complete

Annotations of Ll_transcript_271077

• Blastp: Ethylene-responsive transcription factor ERF017 from Arabidopsis with 44.09% of identity
• Blastx: Ethylene-responsive transcription factor ERF017 from Arabidopsis with 43.55% of identity
• Eggnog: Transcription factor(ENOG410YNX4)
• Kegg: Link to kegg annotations (AT1G19210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457901.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;