Protein coding transcript 134222

• Transcript: Ll_transcript_97081
• CDS coordinates: 92-667 (+)
• Peptide sequence: MASFKLFVYLLSLLAFHLFPSPVFSRDEKKDLLHDLNRYRQLLNLPILTEHHKASCLANEIAEDLEHKPCQDFNYYPVPGIHPKSPNFQENIDKCKININTTNDAIIMPVCVHNLDSDALFLNYTKTYRFTKYLNSSKYTIAGLGSEDDWMVLVLSTNSSSGEFSSATSLLAHAWKGYCLVLALFFTAFFV*
• ORF Type: complete

Annotations of Ll_transcript_97081

• Blastp: Uncharacterized GPI-anchored protein At3g06035 from Arabidopsis with 43.62% of identity
• Blastx: Uncharacterized GPI-anchored protein At3g06035 from Arabidopsis with 43.62% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YJI0)
• Kegg: Link to kegg annotations (AT3G06035)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426799.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;