Protein coding transcript 134324

• Transcript: Ll_transcript_108349
• CDS coordinates: 310-1221 (+)
• Peptide sequence: MSSSYFHFRDSIVKSRILSRLIYNVAPLTTCQQPLPIKYNFSSLLNQFSNTLIHLSSIHTQIIRNWVFDDHFLATKLVKGYSDLGFLTVARHVFDQCSHPETILCNAMMAGYVRNRQYAEVLHLFKMMGSCDIEISGYTCNFALKACTGLLDNEIGMEIVRIAVENGFHLHPYVGSSVINFLVKSGNLDDARVVFNQMPERDVVCWNSIIGGYVHEGHFKEAIRMFLEMIGCGIRPSPVTMASILKACGESGLAKLGRCVHGCVLALDMGNDVFVLTSLVDMYSNLGDTGSATLVFNSMSSRNL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_108349

• Blastp: Pentatricopeptide repeat-containing protein At1g08070, chloroplastic from Arabidopsis with 34.48% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g08070, chloroplastic from Arabidopsis with 34.48% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G08070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445815.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;