Protein coding transcript 134396

• Transcript: Ll_transcript_108200
• CDS coordinates: 97-627 (+)
• Peptide sequence: MAKEKKPETMEEIISSINHACIVAENILDLPNLANKPATLSLSIDEIVKTLSDTKQRLMILSLHGHTSKPSFAHEIVHQPQIDATSMQEWASSSYTQTMDQLLQGERTLPETNMTGKEAMEVLPSRSRKRKVDIEKRTTLVPAPQFGNTEIPPEDGFTWRKYGQKEILGYKYPRFD*
• ORF Type: complete

Annotations of Ll_transcript_108200

• Blastp: WRKY transcription factor 55 from Arabidopsis with 36.17% of identity
• Blastx: WRKY transcription factor 55 from Arabidopsis with 36% of identity
• Eggnog: Transcription factor(ENOG410YNE8)
• Kegg: Link to kegg annotations (AT2G40740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416326.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;