Transcript | Ll_transcript_108200 |
---|---|
CDS coordinates | 97-627 (+) |
Peptide sequence | MAKEKKPETMEEIISSINHACIVAENILDLPNLANKPATLSLSIDEIVKTLSDTKQRLMILSLHGHTSKPSFAHEIVHQPQIDATSMQEWASSSYTQTMDQLLQGERTLPETNMTGKEAMEVLPSRSRKRKVDIEKRTTLVPAPQFGNTEIPPEDGFTWRKYGQKEILGYKYPRFD* |
ORF Type | complete |
Blastp | WRKY transcription factor 55 from Arabidopsis with 36.17% of identity |
---|---|
Blastx | WRKY transcription factor 55 from Arabidopsis with 36% of identity |
Eggnog | Transcription factor(ENOG410YNE8) |
Kegg | Link to kegg annotations (AT2G40740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416326.1) |
Pfam | WRKY DNA -binding domain (PF03106.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer