Protein coding transcript 134605

• Transcript: Ll_transcript_55755
• CDS coordinates: 3-647 (-)
• Peptide sequence: VSSLVESFIHIISTQFDTKIKANRSDNGPEFKLSALYSSNGILHQTSCVETPQQNGVVERKHQHILGVTRAIMFEASLPKCFWNFAAAHVVFLINRKPSKFLSNKSPYEILYNHEPNLLDLRIFGCLCFASSLSHNRKKLDPRARRCVFLGFKPGVKGYVVFDCNNNETFISRNVSFYEKVFPFDIKNKSPSQSMDISLPTSSFNDKDSFLNHDA
• ORF Type: internal

Annotations of Ll_transcript_55755

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 35.03% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 35.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015963386.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;