Protein coding transcript 134614

• Transcript: Ll_transcript_55645
• CDS coordinates: 105-485 (+)
• Peptide sequence: MEDRLGSTSSTIAIDSSNIGFQLLKKHGWKEGSGLGISEQGRIEPVETYVKNNKRGLGADKVKKNIMKPDHSDASKRNSRQEHSQKKTKAAKALSKRVKKMEEVEKKMQEKEFERAFFREFWPENV*
• ORF Type: complete

Annotations of Ll_transcript_55645

• Blastp: G patch domain-containing protein 8 from Mus with 55.56% of identity
• Blastx: G patch domain-containing protein 8 from Mus with 55.56% of identity
• Eggnog: G patch domain containing 8(ENOG410ZHVS)
• Kegg: Link to kegg annotations (237943)
• CantataDB: Link to cantataDB annotations (CNT0002743)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426687.1)
• Pfam: G-patch domain (PF01585.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;