Protein coding transcript 134681

• Transcript: Ll_transcript_55669
• CDS coordinates: 898-1368 (+)
• Peptide sequence: MGHIVFNYQKFQVTDTPGLLKRHDDDRNNLEKLTLAVLSHLPTAVLYVHDLTGECGTSPSDQFSIYKEIRERFTGHLWLDVVSKFDLMKTSPVVYATDEPSEQLDLEKYRKSGPDGAINVSVKTEEGLDELKHRVHELLNLQMAKIITIDNNNQEK*
• ORF Type: complete

Annotations of Ll_transcript_55669

• Blastp: Nucleolar GTP-binding protein 1 from Chaetomium with 32.37% of identity
• Blastx: Nucleolar GTP-binding protein 1 from Chaetomium with 33.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CTHT_0029660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450037.1)
• Pfam: Nucleolar GTP-binding protein 1 (NOG1) (PF06858.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;