Protein coding transcript 134716

• Transcript: Ll_transcript_55622
• CDS coordinates: 78-1013 (+)
• Peptide sequence: MAFSIFFFLLFITFSYFPFSTALSSEAIFDAADVLSDSGFVSMALTLEVIAESFLSNSPSATVFAPSDSAFRKSGQPSFDLLRFHFVPLPLPPQSLRLLTAGAMIPTMFPGKSLTVTTSSSDHITSINNIKITEAPIYDDGFLIIYGTERFFDPNFQHTGPNQRSNNNPSCVAKNHTANSSDSFDQAIETLKSGGFSAMASFLGTQLSGVSEQSGITVFAPADDMVLNRIGDLSELPWFFRRHVVPCKLLWNDLVNFDDESELPTFLEGFTINITRNGGVLVLNGVQVFYPDIFFNDKVAVHGVSDALTAH*
• ORF Type: complete

Annotations of Ll_transcript_55622

• Blastp: Putative fasciclin-like arabinogalactan protein 20 from Arabidopsis with 36.45% of identity
• Blastx: Putative fasciclin-like arabinogalactan protein 20 from Arabidopsis with 36.28% of identity
• Eggnog: fasciclin-like arabinogalactan protein(ENOG4111A65)
• Kegg: Link to kegg annotations (AT5G40940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452442.1)
• Pfam: Fasciclin domain (PF02469.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;