Protein coding transcript 134737

• Transcript: Ll_transcript_55775
• CDS coordinates: 768-1760 (+)
• Peptide sequence: MCISKYVKYGRNSRGYEMAKTFNSKFTHLSPVWYDLKSQQTSLVLEGRHNADKGWISELKKSGEALILPRVVLEAFPAELVRKKKLRNKAIDLIVTECKEMGYDGIVLESWSRWAAYGILHDPNMRNLALQFVKQLGEALHSISSERNSEQQLQLVYVIGPPSSEKLQAHDFGPKDLETLSEAVDGFSLMTYDFSNPHKPGPNAPMKWIQIVLQLLLDTSGNRAKSLAPKILLGINFYGNDFSLSSDSGGGAIIGRGYLTLLEKHKPELQWDKNSGEHFFLYTDDKDIKHAVFYPSLKSISLRLEEALSWGCGISIWEIGQGLDYFFDLL*
• ORF Type: complete

Annotations of Ll_transcript_55775

• Blastp: Chitinase domain-containing protein 1 from Rattus with 39.27% of identity
• Blastx: Chitinase domain-containing protein 1 from Rattus with 39.27% of identity
• Eggnog: Chitinase domain containing 1(ENOG410XQB6)
• Kegg: Link to kegg annotations (100911881)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424064.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;