Protein coding transcript 1348

• Transcript: Ll_transcript_444665
• CDS coordinates: 182-754 (+)
• Peptide sequence: MGNLFVKKPKVTDVDRAILALKTQRRKLAQYQQKLDAVIEAEKQAARDLIREKKKDRALLALKKKKKQEELLKQVDAWLINVEQQLADIELASKQKAVFDSLKAGNDAMKAIQSEINIEDVQKLMDDTEEAKAYQDEINAILGEKLSAEDEEDILAEFENLETQVYGFSLFVLTCNIFQRHPLNSFQVNY*
• ORF Type: complete

Annotations of Ll_transcript_444665

• Blastp: Vacuolar protein sorting-associated protein 20 homolog 2 from Arabidopsis with 84.66% of identity
• Blastx: Vacuolar protein sorting-associated protein 20 homolog 2 from Arabidopsis with 84.66% of identity
• Eggnog: Charged multivesicular body protein(ENOG4111HN3)
• Kegg: Link to kegg annotations (AT5G09260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414284.1)
• Pfam: Snf7 (PF03357.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;