Protein coding transcript 134853

• Transcript: Ll_transcript_253878
• CDS coordinates: 59-523 (+)
• Peptide sequence: MPSLDIHSLLLFSAIFRAILILYGEWQDAHMEVRYTDVDYLVFSDAASLMALGDSPYKRTTYRYSPLLALLLIPNSFIHSSWGKFLFSASDILVGYFIYYILKLRKVPENLCNYSVMTWLFNPFTFTIGTRGNCEPIVCAMILWIIICLMKGMA*
• ORF Type: complete

Annotations of Ll_transcript_253878

• Blastp: GPI mannosyltransferase 1 from Arabidopsis with 81.21% of identity
• Blastx: GPI mannosyltransferase 1 from Arabidopsis with 66.78% of identity
• Eggnog: Mannosyltransferase(ENOG410XRDY)
• Kegg: Link to kegg annotations (AT5G22130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413131.1)
• Pfam: GPI transamidase subunit PIG-U (PF06728.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;