Protein coding transcript 134854

• Transcript: Ll_transcript_253879
• CDS coordinates: 59-589 (+)
• Peptide sequence: MPSLDIHSLLLFSAIFRAILILYGEWQDAHMEVRYTDVDYLVFSDAASLMALGDSPYKRTTYRYSPLLALLLIPNSFIHSSWGKFLFSASDILVGYFIYYILKLRKVPENLCNYSVMTWLFNPFTFTIGTRGNCEPIVCAMILWIIICLMKETCPKELECYSGRDIQRWEWLVYFA*
• ORF Type: complete

Annotations of Ll_transcript_253879

• Blastp: GPI mannosyltransferase 1 from Arabidopsis with 81.08% of identity
• Blastx: GPI mannosyltransferase 1 from Arabidopsis with 65.7% of identity
• Eggnog: Mannosyltransferase(ENOG410XRDY)
• Kegg: Link to kegg annotations (AT5G22130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016179923.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;