Protein coding transcript 134942

• Transcript: Ll_transcript_28100
• CDS coordinates: 97-771 (+)
• Peptide sequence: MERTPQIWRKLVSWVVLSTTLFLLVVMPTSSMMHASAKECSFEAIFNFGDSNSDTGGLSAVYGQAPYPNGITFFHAPAGRFSDGRLIIDFIANSLGLPYLSAHLDSMGSNFSHGANFATAGSTIRPPNRTRSQSGYSPISLDVQSIEFSDFKIRSDLIIKRGGVFESLFPKNIYFSEALYTYDIGQNDLTYGYKLNMTTEQVKAYIPDVVSQFSNAIRVSYLLI*
• ORF Type: complete

Annotations of Ll_transcript_28100

• Blastp: GDSL esterase/lipase At3g26430 from Arabidopsis with 70.19% of identity
• Blastx: GDSL esterase/lipase At3g26430 from Arabidopsis with 73.2% of identity
• Eggnog: GDSL esterase lipase(ENOG410Y9BR)
• Kegg: Link to kegg annotations (AT3G26430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461998.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;