Transcript | Ll_transcript_28100 |
---|---|
CDS coordinates | 97-771 (+) |
Peptide sequence | MERTPQIWRKLVSWVVLSTTLFLLVVMPTSSMMHASAKECSFEAIFNFGDSNSDTGGLSAVYGQAPYPNGITFFHAPAGRFSDGRLIIDFIANSLGLPYLSAHLDSMGSNFSHGANFATAGSTIRPPNRTRSQSGYSPISLDVQSIEFSDFKIRSDLIIKRGGVFESLFPKNIYFSEALYTYDIGQNDLTYGYKLNMTTEQVKAYIPDVVSQFSNAIRVSYLLI* |
ORF Type | complete |
Blastp | GDSL esterase/lipase At3g26430 from Arabidopsis with 70.19% of identity |
---|---|
Blastx | GDSL esterase/lipase At3g26430 from Arabidopsis with 73.2% of identity |
Eggnog | GDSL esterase lipase(ENOG410Y9BR) |
Kegg | Link to kegg annotations (AT3G26430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461998.1) |
Pfam | GDSL-like Lipase/Acylhydrolase (PF00657.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer