Protein coding transcript 134992

• Transcript: Ll_transcript_28062
• CDS coordinates: 3-692 (+)
• Peptide sequence: KAEMCLWEEQWLYCASQLSQWDALADFAKSVENYEILLDSLWKLPDWTYMKDHVIPKAQVEETPKLRLIQAYFALHEKNTNGVGDAENMVGKGVDLALEQWWQLPEMSVHSRIPLLQQFQQIVEVQESGRILLDISNGNKLSGNSGVGVQGNLYADLKDILETWRLRTPNEWDNMSVWYDLLQWRNEMYNHVIEAFKDFGSTNSALHHLGYRDKAWTVNRLAHIARKQGL
• ORF Type: internal

Annotations of Ll_transcript_28062

• Blastp: Transcription-associated protein 1 from Schizosaccharomyces with 30.4% of identity
• Blastx: Transcription-associated protein 1 from Schizosaccharomyces with 30.4% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBP16F5.03c)
• CantataDB: Link to cantataDB annotations (CNT0000204)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421111.1)
• Pfam: FAT domain (PF02259.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;