Protein coding transcript 134993

• Transcript: Ll_transcript_28063
• CDS coordinates: 2-355 (+)
• Peptide sequence: WVTLHKEEQVTLAKPMITLLSKDYHKRQQASRPNVVQALLEGLQLSHPQPRMPSELIKYIGKTYNAWHIALALLESHVMLFPNDSKCSESLAELYRLLNEEDMRCGLWKKRSVTAETR
• ORF Type: internal

Annotations of Ll_transcript_28063

• Blastp: Transcription-associated protein 1 from Saccharomyces with 38.46% of identity
• Blastx: Transcription-associated protein 1 from Saccharomyces with 38.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YHR099W)
• CantataDB: Link to cantataDB annotations (CNT0000204)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421111.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;