Transcript | Ll_transcript_28063 |
---|---|
CDS coordinates | 2-355 (+) |
Peptide sequence | WVTLHKEEQVTLAKPMITLLSKDYHKRQQASRPNVVQALLEGLQLSHPQPRMPSELIKYIGKTYNAWHIALALLESHVMLFPNDSKCSESLAELYRLLNEEDMRCGLWKKRSVTAETR |
ORF Type | internal |
Blastp | Transcription-associated protein 1 from Saccharomyces with 38.46% of identity |
---|---|
Blastx | Transcription-associated protein 1 from Saccharomyces with 38.46% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YHR099W) |
CantataDB | Link to cantataDB annotations (CNT0000204) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421111.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer