Protein coding transcript 134997

• Transcript: Ll_transcript_28178
• CDS coordinates: 118-969 (+)
• Peptide sequence: MSSNNPPHQDNSNRNWSLQDFEIGKPLGRGKFGRVYVARERKSKYVVALKIIFKEQIKKHKIDHQLVREMEIQTSLRHPNILRLFGWFHDAERVFLILEYAHNGELYKELRKRGHLSEKHAATYILSLTKALAYCHEKHVIHRDIKPENLLLDHEGRLKIADFGWSVQSSNKRHTMCGTLDYLAPEMVENKAHDYTVDNWTLGILCYEFLYGVPPFEAESQLDTFRRILKVDLSFPSTPSISLDAKNLISRLLVKDSSRRLSLQKIVEHPWILKNANPMGICK*
• ORF Type: complete

Annotations of Ll_transcript_28178

• Blastp: Serine/threonine-protein kinase Aurora-3 from Arabidopsis with 79.78% of identity
• Blastx: Serine/threonine-protein kinase Aurora-3 from Arabidopsis with 79.78% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XNRB)
• Kegg: Link to kegg annotations (AT2G45490)
• CantataDB: Link to cantataDB annotations (CNT0002436)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432276.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;