Transcript | Ll_transcript_28180 |
---|---|
CDS coordinates | 210-536 (+) |
Peptide sequence | MCGTLDYLAPEMVENKAHDYTVDNWTLGILCYEFLYGVPPFEAESQLDTFRRILKVDLSFPSTPSISLDAKNLISRLLVKDSSRRLSLQKIVEHPWILKNANPMGICK* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase Aurora-3 from Arabidopsis with 78.5% of identity |
---|---|
Blastx | Serine/threonine-protein kinase Aurora-3 from Arabidopsis with 80.47% of identity |
Eggnog | serine threonine-protein kinase(ENOG410XNRB) |
Kegg | Link to kegg annotations (AT2G45490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432276.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer