Transcript | Ll_transcript_28120 |
---|---|
CDS coordinates | 34-438 (+) |
Peptide sequence | MYHPTRGGVRGGRDQFTWEDVKVDKHRENYLGHSIKAPVGRWQKGKDLHWYTRDKKSLDAEMEVAKEEIKRIKEEEEQAMREALGLAPKRANRPQGNRLDKHEFSELVKRGSTAEDLGAGHAEAASVQGLGFAR* |
ORF Type | complete |
Blastp | Multiple myeloma tumor-associated protein 2 homolog from Mus with 50% of identity |
---|---|
Blastx | Multiple myeloma tumor-associated protein 2 homolog from Mus with 50% of identity |
Eggnog | Chromosome 1 open reading frame 35(ENOG41123ER) |
Kegg | Link to kegg annotations (67862) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462427.1) |
Pfam | Kinase phosphorylation protein (PF10159.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer