Protein coding transcript 135043

• Transcript: Ll_transcript_28188
• CDS coordinates: 273-623 (+)
• Peptide sequence: MQMKPNPQCSNVACLTRQEEYALAKPERDAAAKAKLEAELPTEEGPLHDDNEWNISVVDDSEPEGLDTRSSDALPEGLTHELPTADAFQKLPTDAPVTDNDDLEDLRKQLEAINSA*
• ORF Type: complete

Annotations of Ll_transcript_28188

• Blastp: Ubiquitin-like modifier-activating enzyme 5 from Arabidopsis with 65.6% of identity
• Blastx: Ubiquitin-like modifier-activating enzyme 5 from Arabidopsis with 68.38% of identity
• Eggnog: small protein activating enzyme activity(COG0476)
• Kegg: Link to kegg annotations (AT1G05350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416843.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;