Transcript | Ll_transcript_97494 |
---|---|
CDS coordinates | 1114-2190 (+) |
Peptide sequence | MLKSEFVAVSEKNAELKKQVRELTERLRLAEQGKDQAQKQFLVLGKQQKAGPFGTVKGLRTTPTVVPDESVNPRLANILEKVAVKQELIVALANSKVKEMLEVWFTNIKRVGISNYLVVALDEETAKYCEANQVPFYKRDPDEGIDAIGKIGGNHAVSGLKFRILREFLQLGYSVLLSDVDIVYLQNPFDHLYRDSDVESMSDGHDNMTAYGYNDVFDEPAMGWARFAHTMRIWVYNSGFFYIRPTIPSVELLDRVATRLSNEKAWDQAVFNEELFYPSHPGYDGLHAARRTMDIYQFMNSKVLFKTVRYDANLSKLKPVIIHVNYHPDKLPRMKAIVEYYVNGKQDALKPFPEGSDW* |
ORF Type | complete |
Blastp | Arabinosyltransferase RRA3 from Arabidopsis with 76.26% of identity |
---|---|
Blastx | Arabinosyltransferase RRA3 from Arabidopsis with 75.27% of identity |
Eggnog | Nucleotide-diphospho-sugar transferase(ENOG410YBEW) |
Kegg | Link to kegg annotations (AT1G19360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448513.1) |
Pfam | Nucleotide-diphospho-sugar transferase (PF03407.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer