Transcript | Ll_transcript_104122 |
---|---|
CDS coordinates | 221-574 (+) |
Peptide sequence | MALRAAVLRHLRVPIQTAPWRGGASLRLMSSHDDHITKDEVIDRVLSVVKDFPKVDPSKVSPDVHFQKDLGLDSLDNVEIVMALEEEFKLEIPDKEAVKIDSTHLAIEYISNHPMSS* |
ORF Type | complete |
Blastp | Acyl carrier protein 1, mitochondrial from Arabidopsis with 69.67% of identity |
---|---|
Blastx | Acyl carrier protein 1, mitochondrial from Arabidopsis with 69.67% of identity |
Eggnog | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity)(COG0236) |
Kegg | Link to kegg annotations (AT2G44620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454418.1) |
Pfam | Phosphopantetheine attachment site (PF00550.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer