Protein coding transcript 13561

• Transcript: Ll_transcript_400584
• CDS coordinates: 1661-2362 (+)
• Peptide sequence: MTSFPSRKFYVSYLKSMTFFIMNVQANFAKWEPGHGKFKFHHPWDQYLKIGSLTHQCAYRMEALEQYLNSNTQGSSEIRSMIQEVSLEMTMESSKALKELGLSIKTMTRSSSADIHIANSKAASKRLKSLLQSSLREETDLLSVIPVGTVASLLIDITDFTEKLSDCVNYLASLTNFDGVETNKYPQISESLYCECSDPDPNIDTSHVVVILVEGSSEAKPCGKSLSVQHNNV*
• ORF Type: complete

Annotations of Ll_transcript_400584

• Blastp: Aluminum-activated malate transporter 2 from Arabidopsis with 67.65% of identity
• Blastx: Aluminum-activated malate transporter 2 from Arabidopsis with 67.65% of identity
• Eggnog: aluminum-activated malate transporter(ENOG410XR8V)
• Kegg: Link to kegg annotations (AT1G08440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465184.1)
• Pfam: Aluminium activated malate transporter (PF11744.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;