Protein coding transcript 135768

• Transcript: Ll_transcript_4738
• CDS coordinates: 3-887 (+)
• Peptide sequence: LQYVQRKFIATYPSFCFVPLFVALAMICGSKAFDVRFQQNYKVTWGNHHHVFFVDHGREVQLSIDKTSGAGFQSKLDYASGFFQMRIKIPNKDCRGIVTAFYLSSKAYDEHLGRNHDEIDFEFLGNNGEPYTLQTNIFARDEGGREQRIHLWFDPTINFHTYGILWNQHQIVFYVDDTPIRVFKNKSNIGVNYPSQQMHITCSIWNGEPWASNVKRINWRQAPFMAQFQGFNIHGCQYYNKPNKAACYSPHLWWNHNRFWELNLQQQRAYEDVRKKYLFYDYCSDRGMLHKECKI
• ORF Type: internal

Annotations of Ll_transcript_4738

• Blastp: Xyloglucan endotransglucosylase/hydrolase protein 2 from Arabidopsis with 54.24% of identity
• Blastx: Xyloglucan endotransglucosylase/hydrolase protein 2 from Arabidopsis with 54.24% of identity
• Eggnog: hydrolase family 16(COG2273)
• Kegg: Link to kegg annotations (AT4G13090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450789.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;