Protein coding transcript 135783

• Transcript: Ll_transcript_4741
• CDS coordinates: 291-827 (+)
• Peptide sequence: MRFPFVGFITILVLLVLPSHSSSSTPGNIEKEKTLAIIKPDGLLGNYTDDIKRTVLEYGFRIFKEKTVQFDEATVKRFYAEHSSKSFFSSLTKYMTSGPVLVMVLEKDNAIADWRALMGPTDARKAKITHPHSVRAMCGLDTQKNCVHGSDSTKSAEREISFFFRELSADVITEHDEL*
• ORF Type: complete

Annotations of Ll_transcript_4741

• Blastp: Probable nucleoside diphosphate kinase 5 from Arabidopsis with 65.97% of identity
• Blastx: Probable nucleoside diphosphate kinase 5 from Arabidopsis with 65.97% of identity
• Eggnog: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity)(COG0105)
• Kegg: Link to kegg annotations (AT1G17410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461922.1)
• Pfam: Nucleoside diphosphate kinase (PF00334.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;