Protein coding transcript 135797

• Transcript: Ll_transcript_4897
• CDS coordinates: 56-445 (+)
• Peptide sequence: MGSFFSSLANDSASPPLPENSQVKSFHSSARWQLHFNELKDSSRLVVIDFSASWCGPCKFIEPAIHAMADKFTDVEFIKIDVDELSDVAREFQVQAMPTFVLVKKGKETDRVVGAKKDELERKIEKHRS*
• ORF Type: complete

Annotations of Ll_transcript_4897

• Blastp: Thioredoxin H2 from Arabidopsis with 64.34% of identity
• Blastx: Thioredoxin H2 from Arabidopsis with 64.34% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT5G39950)
• CantataDB: Link to cantataDB annotations (CNT0002966)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439852.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;