Transcript | Ll_transcript_4831 |
---|---|
CDS coordinates | 77-529 (+) |
Peptide sequence | MGKAKKSPKFAVMKKVITSKAIKSYKEDILNPNKKDLLKEKLPRNVPSQSSALFFQYNTALGPPYHVLVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERILCTHKGTYADDCLVERVTQV* |
ORF Type | complete |
Blastp | rRNA-processing protein FCF1 homolog from Pongo with 68.83% of identity |
---|---|
Blastx | rRNA-processing protein FCF1 homolog from Pongo with 68.83% of identity |
Eggnog | small subunit (SSU) processome component, homolog(COG1412) |
Kegg | Link to kegg annotations (100171429) |
CantataDB | Link to cantataDB annotations (CNT0001523) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433623.1) |
Pfam | Fcf1 (PF04900.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer