| Transcript | Ll_transcript_4832 |
|---|---|
| CDS coordinates | 77-421 (+) |
| Peptide sequence | MGKAKKSPKFAVMKKVITSKAIKSYKEDILNPNKKDLLKEKLPRNVPSQSSALFFQYNTALGPPYHVLVDTNFINFSIQNKLDLEKGMMDCLYAKCEFEIDNSLSYFMNFIFMY* |
| ORF Type | complete |
| Blastp | rRNA-processing protein FCF1 from Saccharomyces with 55.21% of identity |
|---|---|
| Blastx | rRNA-processing protein FCF1 from Saccharomyces with 55.21% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YDR339C) |
| CantataDB | Link to cantataDB annotations (CNT0001523) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433623.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer