Transcript | Ll_transcript_4946 |
---|---|
CDS coordinates | 153-575 (+) |
Peptide sequence | MASISATSLMFKPSLKLSSSTTQASYRISSLRTISVGWTKRSSPSLRTTGFRISCAVQPKTLEKVVEVVKKQLALPAETELTPDTKFTALGADSLDTVEIVMNLEEEFGINVENENSENITTVQEAAELIEKLIQKKGEA* |
ORF Type | complete |
Blastp | Acyl carrier protein 4, chloroplastic from Cuphea with 53.52% of identity |
---|---|
Blastx | Acyl carrier protein 4, chloroplastic from Cuphea with 52.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416157.1) |
Pfam | Phosphopantetheine attachment site (PF00550.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer