Protein coding transcript 135838

• Transcript: Ll_transcript_4946
• CDS coordinates: 153-575 (+)
• Peptide sequence: MASISATSLMFKPSLKLSSSTTQASYRISSLRTISVGWTKRSSPSLRTTGFRISCAVQPKTLEKVVEVVKKQLALPAETELTPDTKFTALGADSLDTVEIVMNLEEEFGINVENENSENITTVQEAAELIEKLIQKKGEA*
• ORF Type: complete

Annotations of Ll_transcript_4946

• Blastp: Acyl carrier protein 4, chloroplastic from Cuphea with 53.52% of identity
• Blastx: Acyl carrier protein 4, chloroplastic from Cuphea with 52.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416157.1)
• Pfam: Phosphopantetheine attachment site (PF00550.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;