Protein coding transcript 135963

• Transcript: Ll_transcript_176034
• CDS coordinates: 988-1431 (+)
• Peptide sequence: MLPVGTNVTVKPKQFLDRTIGFTINYAKEDPRDPRELSEFPDIRLWFVRLDATYPWLPVLLDWRAGELARYAAMLVPHQMNMKMGVVFNPEALELFVMKKVFIVYSWLKHHNIPKPKLKTNDMARMLGFGIGDELYDLIENHPLDLS*
• ORF Type: complete

Annotations of Ll_transcript_176034

• Blastp: Protein CHLORORESPIRATORY REDUCTION 6, chloroplastic from Arabidopsis with 79.85% of identity
• Blastx: Protein CHLORORESPIRATORY REDUCTION 6, chloroplastic from Arabidopsis with 79.85% of identity
• Eggnog: Domain of unknown function (DUF1817)(COG5474)
• Kegg: Link to kegg annotations (AT2G47910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462549.1)
• Pfam: Chlororespiratory reduction 6 (PF08847.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;