Protein coding transcript 135967

• Transcript: Ll_transcript_175979
• CDS coordinates: 1-471 (+)
• Peptide sequence: RVSAAAMQAPKKTREPIQAVQVFGRKKTATAVAYCRRGNGNLRVNGRPLEMVEPRVLQYKLQEPILLLGKDRFAGVDIRVRVNGGGHVSQIYAIRQAISKALVAYYQKYVDEASKKEMKDVLIQYDRTLLVADPRRCEPKKFGGPGARARYQKSYR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175979

• Blastp: 40S ribosomal protein S16 from Sophophora with 86.99% of identity
• Blastx: 40S ribosomal protein S16 from Sophophora with 86.99% of identity
• Eggnog: 30S ribosomal protein S9(COG0103)
• Kegg: Link to kegg annotations (Dmel_CG4046)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014507757.1)
• Pfam: Ribosomal protein S9/S16 (PF00380.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;