Protein coding transcript 136

• Transcript: Ll_transcript_458864
• CDS coordinates: 2-742 (+)
• Peptide sequence: HGFFSDPKKKKKNIHKNSGISILNSRIKAAPELKPDVDKVITFLGRPWKKYARVAIMHTFLDTLVNPKGWSPWNSSDFALDTLYFGEYKNYGPGSSICDRVEWPTFHAMTSSSEAFQFTIHGFFSDPKKKKKNIHKNSGISILNSRIKAAPELKPDVDKVITFLGRPWKKYARVAIMHTFLDTLVNPKGWSPWNSSDFALDTLYFGEYKNYGPGSSICDRVEWPTFHAMTSSSEAFQFTIHGFFSDP
• ORF Type: internal

Annotations of Ll_transcript_458864

• Blastp: Pectinesterase 2 from Citrus with 52.25% of identity
• Blastx: Pectinesterase 2 from Citrus with 52.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102577945)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430580.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;