Protein coding transcript 136003

• Transcript: Ll_transcript_175807
• CDS coordinates: 1-477 (+)
• Peptide sequence: EMFGKHWMTWIEVCPMFLSDYDATRAYALSKLANLYHTTELARRLQQMEANVTVNCVHPGVVRTRLTREREGLLTDLVFFLGSKLLKTIPQAAATTCYVATHPSLLNVSNKFFCDCNEGYTSKLGCNSTEEAGLWAASELIISKGPKAAFDLLKNPQF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175807

• Blastp: Short-chain dehydrogenase TIC 32, chloroplastic from Pisum with 39.32% of identity
• Blastx: Short-chain dehydrogenase TIC 32, chloroplastic from Pisum with 39.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420506.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;