| Transcript | Ll_transcript_408051 |
|---|---|
| CDS coordinates | 1-414 (+) |
| Peptide sequence | VILMARPNSLIFLFLLISITSLVAVSLKWPLNYVHIYIENGLDNSTPLIFHCKSKQRDLGEQVLKNGEEFKFQFTLKFRKQTLYSCSFSWDGKLHSFDIYDQHRDNCNNDCKWIIRSAYPCKFDFVSQNYNMCNQYH* |
| ORF Type | 5prime_partial |
| Blastp | - |
|---|---|
| Blastx | S-protein homolog 2 from Arabidopsis with 42.34% of identity |
| Eggnog | Plant self-incompatibility protein S1(ENOG410ZGCR) |
| Kegg | Link to kegg annotations (AT4G16195) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_013466368.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer