Protein coding transcript 136287

• Transcript: Ll_transcript_62194
• CDS coordinates: 1-339 (+)
• Peptide sequence: GKVALEMNKMIASFSDEKLKILYESSMRAPQTLQLGEICSIFGISSSPRFNVFGNNFGWGKPLGVRSGNSYGTSATLFAGAEEGSMDLTVCLPYEVLEAIGNDPLFMDPFPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_62194

• Blastp: Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 35.96% of identity
• Blastx: Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 35.96% of identity
• Eggnog: Transferase Family(ENOG410YEZS)
• Kegg: Link to kegg annotations (AT3G50280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459642.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;