Transcript | Ll_transcript_62195 |
---|---|
CDS coordinates | 1-342 (+) |
Peptide sequence | GKVALEMNKMIASFSDEKLKILYESWVGPPKFLLRGLNNTFGVSNSPRFNVYGNDFGWGKPLAVRSGSTSTKNGYTVLFAGPEEGSIDLTLSLPYEVLEAIGNDPHFMDPFST* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 41.82% of identity |
---|---|
Blastx | Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 41.82% of identity |
Eggnog | Transferase Family(ENOG410YEZS) |
Kegg | Link to kegg annotations (AT3G50280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459676.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer