Protein coding transcript 136366

• Transcript: Ll_transcript_12843
• CDS coordinates: 232-903 (+)
• Peptide sequence: MASSFTLSSSSFSSAFPLSHFRVCKNFKLFSGLHRINSTITNGHAPDLASVRMKSKFASSDGRIKATLASGGDLRGIESVGTEVQPDAIAFATLGADTALASNAFADDSDEFDLDRPTDGFASIPEAIKDVQNGKMVVVVDDEDRENEGDLIMAAELATPEAMAFIVRHGTGIVCISMKEEDLERLELPLMVNSRDNDEKLRTAFTVTVVCMYICYRHLYIRS*
• ORF Type: complete

Annotations of Ll_transcript_12843

• Blastp: Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic from Arabidopsis with 72.18% of identity
• Blastx: Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic from Arabidopsis with 72.18% of identity
• Eggnog: Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate (By similarity)(COG0108)
• Kegg: Link to kegg annotations (AT2G22450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445549.1)
• Pfam: 3,4-dihydroxy-2-butanone 4-phosphate synthase (PF00926.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;