Protein coding transcript 136411

• Transcript: Ll_transcript_12794
• CDS coordinates: 1-684 (+)
• Peptide sequence: KICAPINMGGLGLKSIKFMNKATLLKLSWLMLSSDQEWASFYRLRFGNNYNLSTRYFKSSIWHIIKQNWSLLHFNSIILVGDGKSTNFWKDNWLGVPLIDYLQIPKHLHCLLHAKVADFLQGPNWLIPSNLMAAVPDLAGKLSKVITTNNKDKFIWMGSSDEQLSSKDAYLHLSPVVQQSNLFKKLWSKAIPPSKSFITWRWMHQKLPTDDNLMQRGCQGVSMCSLC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_12794

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 24.7% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 24.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460146.1)
• Pfam: zinc-binding in reverse transcriptase (PF13966.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;