Protein coding transcript 136437

• Transcript: Ll_transcript_12898
• CDS coordinates: 53-436 (+)
• Peptide sequence: MGANISNMECYPYASPQSSHILTFHSTSKWKAHFDASKGMNKLMVIDFTATWCGPCKYMDHVIQDFAAKYIEVEFIKIDVDELMGVSQEFQVQAMPAFILMKKGKVVDKLVGAKTEELEALIEKHLN*
• ORF Type: complete

Annotations of Ll_transcript_12898

• Blastp: Thioredoxin H2 from Arabidopsis with 46.3% of identity
• Blastx: Thioredoxin H2 from Arabidopsis with 46.3% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT5G39950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460362.1)
• Pfam: Phosducin (PF02114.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;