Protein coding transcript 136439

• Transcript: Ll_transcript_13060
• CDS coordinates: 200-535 (+)
• Peptide sequence: MNNSSSPAHSSLSTTTAVGGGGGGSNATASFDDLHFPSDPISFSTQLRKDESMLVLKSDLMAALDKEVKSLDEDNWKFEGPRSRIHLVSRPGGYLHKPTEISKNWNLTLPK*
• ORF Type: complete

Annotations of Ll_transcript_13060

• Blastp: Protein SAMBA from Arabidopsis with 64.08% of identity
• Blastx: Protein SAMBA from Arabidopsis with 64.79% of identity
• Eggnog: NA(ENOG410Z6S4)
• Kegg: Link to kegg annotations (AT1G32310)
• CantataDB: Link to cantataDB annotations (CNT0001173)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445282.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;