Transcript | Ll_transcript_13064 |
---|---|
CDS coordinates | 200-535 (+) |
Peptide sequence | MNNSSSPAHSSLSTTTAVGGGGGGSNATASFDDLHFPSDPISFSTQLRKDESMLVLKSDLMAALDKEVKSLDEDNWKFEGPRSRIHLVSRPGGYLHKPTEISKNWNLTLPK* |
ORF Type | complete |
Blastp | Protein SAMBA from Arabidopsis with 64.08% of identity |
---|---|
Blastx | Protein SAMBA from Arabidopsis with 64.79% of identity |
Eggnog | NA(ENOG410Z6S4) |
Kegg | Link to kegg annotations (AT1G32310) |
CantataDB | Link to cantataDB annotations (CNT0001173) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445282.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer