Protein coding transcript 136480

• Transcript: Ll_transcript_13077
• CDS coordinates: 808-1230 (+)
• Peptide sequence: MLMTVICHSVLFTRYASAPQELRMNWDNFTKDYFLNRSTLVSVFLLIDASIPAKQIDLDYASWLGQNQIPMTIIFTKCDKRKKRKNGGRRPEENVNDFQDLIRGFFETVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH*
• ORF Type: complete

Annotations of Ll_transcript_13077

• Blastp: GTP-binding protein At2g22870 from Arabidopsis with 58.54% of identity
• Blastx: GTP-binding protein At2g22870 from Arabidopsis with 56.91% of identity
• Eggnog: Necessary for normal cell division and for the maintenance of normal septation (By similarity)(COG0218)
• Kegg: Link to kegg annotations (AT2G22870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417758.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;