Protein coding transcript 136483

• Transcript: Ll_transcript_13081
• CDS coordinates: 109-660 (+)
• Peptide sequence: MGGLLHLQRFPLSIFLRSHSPKFPTRTTLFFSPKSTLTTPEPLTDNDSPSDSETPHVQLSLDKLFIPPDTRVPVDSGSARILKGSNIVLSNYARDSNVVQADYVKSSVRTEDCPSDGLPEFALVGRSNVGKSSLLNSIVRRKKLALTSKKPGPEPNLFFVLYLLNCDSRACSRVSSVGRVAMSG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_13081

• Blastp: GTP-binding protein At2g22870 from Arabidopsis with 42.86% of identity
• Blastx: GTP-binding protein At2g22870 from Arabidopsis with 42.86% of identity
• Eggnog: Necessary for normal cell division and for the maintenance of normal septation (By similarity)(COG0218)
• Kegg: Link to kegg annotations (AT2G22870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417758.1)
• Pfam: 50S ribosome-binding GTPase (PF01926.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;