Protein coding transcript 136485

• Transcript: Ll_transcript_13074
• CDS coordinates: 264-674 (+)
• Peptide sequence: MVMGESRLIVEEDFVITSEEMFSPPRSPKPLLMKINSIVSMKSSKSYNRLPSQPLTLSILKLDASFFHVEVSKNASVGELKHAVEAIFSHMPQKISWPLVWGQFCLCYEGHRLVVETDYLRDYGIHDGDQVCHFSC*
• ORF Type: complete

Annotations of Ll_transcript_13074

• Blastp: U11/U12 small nuclear ribonucleoprotein 25 kDa protein from Bos with 31.19% of identity
• Blastx: U11/U12 small nuclear ribonucleoprotein 25 kDa protein from Mus with 31.82% of identity
• Eggnog: u11 U12 small nuclear ribonucleoprotein 25 kDa(ENOG4111HGM)
• Kegg: Link to kegg annotations (513526)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416954.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;