Transcript | Ll_transcript_12776 |
---|---|
CDS coordinates | 1-354 (+) |
Peptide sequence | KASRFQARAVLCSLSEGDVNAVTELNSLLQKKVMYCLEHHRSMDIAVTTHEDMLLLSDVCFLADEFWESRLRIVFQLLFSSIKLGAKHPAISEHIILPCLRIVSQACTLPKPDTPDKE |
ORF Type | internal |
Blastp | Auxin transport protein BIG from Arabidopsis with 77.12% of identity |
---|---|
Blastx | Auxin transport protein BIG from Arabidopsis with 77.12% of identity |
Eggnog | Ubiquitin protein ligase E3 component n-recognin 4(ENOG410XPP8) |
Kegg | Link to kegg annotations (AT3G02260) |
CantataDB | Link to cantataDB annotations (CNT0002836) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452981.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer