Protein coding transcript 136491

• Transcript: Ll_transcript_12776
• CDS coordinates: 1-354 (+)
• Peptide sequence: KASRFQARAVLCSLSEGDVNAVTELNSLLQKKVMYCLEHHRSMDIAVTTHEDMLLLSDVCFLADEFWESRLRIVFQLLFSSIKLGAKHPAISEHIILPCLRIVSQACTLPKPDTPDKE
• ORF Type: internal

Annotations of Ll_transcript_12776

• Blastp: Auxin transport protein BIG from Arabidopsis with 77.12% of identity
• Blastx: Auxin transport protein BIG from Arabidopsis with 77.12% of identity
• Eggnog: Ubiquitin protein ligase E3 component n-recognin 4(ENOG410XPP8)
• Kegg: Link to kegg annotations (AT3G02260)
• CantataDB: Link to cantataDB annotations (CNT0002836)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452981.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;