Protein coding transcript 136495

• Transcript: Ll_transcript_12877
• CDS coordinates: 88-453 (+)
• Peptide sequence: MALLHNLSLFSTSTPLHLSTSKPSLSIYSFPFHSSHLGFPSQSLSLKQNHHQPSKKLTFSLTESVSSTALIALLSASLFFVDPALAFKGGGPYGQEVTRGQDLTGKDFSGKTLIKQDFKTV*
• ORF Type: complete

Annotations of Ll_transcript_12877

• Blastp: Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 55.83% of identity
• Blastx: Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 55.83% of identity
• Eggnog: Pentapeptide repeat-containing protein(ENOG4111W3N)
• Kegg: Link to kegg annotations (AT2G44920)
• CantataDB: Link to cantataDB annotations (CNT0000276)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417969.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;