Protein coding transcript 136496

• Transcript: Ll_transcript_12879
• CDS coordinates: 88-777 (+)
• Peptide sequence: MALLHNLSLFSTSTPLHLSTSKPSLSIYSFPFHSSHLGFPSQSLSLKQNHHQPSKKLTFSLTESVSSTALIALLSASLFFVDPALAFKGGGPYGQEVTRGQDLTGKDFSGKTLIKQDFKTSILRQTNFKGAKLLGASFFDADLTGADLSDADLRSADFSLANVTKVNLSNANLEGALVTGNTSFKGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCK*
• ORF Type: complete

Annotations of Ll_transcript_12879

• Blastp: Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 73.68% of identity
• Blastx: Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 73.33% of identity
• Eggnog: Pentapeptide repeat-containing protein(ENOG4111W3N)
• Kegg: Link to kegg annotations (AT2G44920)
• CantataDB: Link to cantataDB annotations (CNT0000276)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417969.1)
• Pfam: Pentapeptide repeats (9 copies) (PF13599.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;