Transcript | Ll_transcript_12879 |
---|---|
CDS coordinates | 88-777 (+) |
Peptide sequence | MALLHNLSLFSTSTPLHLSTSKPSLSIYSFPFHSSHLGFPSQSLSLKQNHHQPSKKLTFSLTESVSSTALIALLSASLFFVDPALAFKGGGPYGQEVTRGQDLTGKDFSGKTLIKQDFKTSILRQTNFKGAKLLGASFFDADLTGADLSDADLRSADFSLANVTKVNLSNANLEGALVTGNTSFKGSNITGADFTDVPLRDDQREYLCKVADGVNPTTGNATRDTLLCK* |
ORF Type | complete |
Blastp | Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 73.68% of identity |
---|---|
Blastx | Thylakoid lumenal 15 kDa protein 1, chloroplastic from Arabidopsis with 73.33% of identity |
Eggnog | Pentapeptide repeat-containing protein(ENOG4111W3N) |
Kegg | Link to kegg annotations (AT2G44920) |
CantataDB | Link to cantataDB annotations (CNT0000276) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417969.1) |
Pfam | Pentapeptide repeats (9 copies) (PF13599.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer